What is the catalog number for MTFR1 Peptide - middle region?

The catalog number for MTFR1 Peptide - middle region is orb1999548.

What sizes are available for MTFR1 Peptide - middle region?

MTFR1 Peptide - middle region is available in the following size(s): 100 µg.

Is MTFR1 Peptide - middle region in stock?

MTFR1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MTFR1 Peptide - middle region

Product Specifications

Product Name Alternative

CHPPR, FAM54A2

UniProt

Q15390

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139310.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRKIGTNLSLIQCPRVQFQINSHATEWSPSHPGEDAVASFADVGWVAKEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-37828CL1 0.1 mL

Mouse Monoclonal GAPDH Antibody (GA1R) [CoraFluor 1]

Sign In for Pricing

View Details

ELI-05760m 96 Tests

Mouse Max dimerization protein 1, Mxd1 ELISA KIT

Sign In for Pricing

View Details

sc-88156-PR 10 µM - 20 µL

OR5BU1 (h) -PR

Sign In for Pricing

View Details

MBS2164765-01 0.1 mL

PE-Linked Polyclonal Antibody to Tuftelin (TUFT)

Sign In for Pricing

View Details

MBS2164765-02 0.2 mL

PE-Linked Polyclonal Antibody to Tuftelin (TUFT)

Sign In for Pricing

View Details

MBS2164765-03 0.5 mL

PE-Linked Polyclonal Antibody to Tuftelin (TUFT)

Sign In for Pricing

View Details