PITRM1 Peptide - middle region

Product Specifications

Product Name Alternative

MP1, PreP

UniProt

Q5JRX3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001229236.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQN

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAB7473CL1 0.1 mL

Rabbit Monoclonal IL-7R alpha/CD127 Antibody (1140A) [CoraFluor 1]

View Details

MBS6470563-01 0.1 mL

Creatine Kinase MM Isoenzyme (CKMM, Creatine Kinase M, Muscle Creatine Kinase, M-CK) (MaxLight 550)

View Details

MBS6470563-02 5x 0.1 mL

Creatine Kinase MM Isoenzyme (CKMM, Creatine Kinase M, Muscle Creatine Kinase, M-CK) (MaxLight 550)

View Details

20294034 100 µg

FBXL17 Protein Lysate (Mouse) with C-HA Tag

View Details

MBS9908394 Inquire

Goose Dihydropyrimidinase-Related Protein 5 (DPYSL5) ELISA Kit

View Details

LV770931 1.0 µg DNA

MRPS5P3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

View Details