Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITRM1 Peptide - middle region

PITRM1 Peptide - middle region

Product Specifications

Product Name Alternative

MP1, PreP

UniProt

Q5JRX3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001229236.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sord shRNA (UAS) - Lentiviral mouse Sord shRNA (UAS) plasmid
GTR15278227 1 Vial

Lentiviral mouse Sord shRNA (UAS) - Lentiviral mouse Sord shRNA (UAS) plasmid

Sign In for Pricing
View Details
KDM1B Protein Lysate (Human) with C-Ha Tag
25469031 100 µg

KDM1B Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
BAD Antibody
MBS8512473-01 0.05 mg

BAD Antibody

Sign In for Pricing
View Details
BAD Antibody
MBS8512473-02 0.1 mg

BAD Antibody

Sign In for Pricing
View Details
BAD Antibody
MBS8512473-03 0.1 mL (AF750)

BAD Antibody

Sign In for Pricing
View Details
BAD Antibody
MBS8512473-04 0.1 mL (AF405M)

BAD Antibody

Sign In for Pricing
View Details