Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R3C Peptide - N-terminal region

PPP2R3C Peptide - N-terminal region

Product Specifications

Product Name Alternative

G4-1, G5pr, C14orf10

UniProt

Q969Q6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060387.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker), 0.2mg/mL
BNUB1662-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS711456 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Human CNOT1 activation kit by CRISPRa
GA107973 1 Kit

Human CNOT1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human p400 (EP400) activation kit by CRISPRa
GA111649 1 Kit

Human p400 (EP400) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS631564 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Sirt3 Mouse Gene Knockout Kit (CRISPR)
KN515803 1 Kit

Sirt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details