Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R3C Peptide - N-terminal region

PPP2R3C Peptide - N-terminal region

Product Specifications

Product Name Alternative

G4-1, G5pr, C14orf10

UniProt

Q969Q6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060387.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chlorouracil
TRC-C423780-10G 10 g

6-Chlorouracil

Sign In for Pricing
View Details
Dapagliflozin Keto Impurity
TRC-D185395-10MG 10 mg

Dapagliflozin Keto Impurity

Sign In for Pricing
View Details
Cytokeratin 7 Recombinant Rabbit monoclonal Antibody
HA750185 100 µL

Cytokeratin 7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
N-Nitroso-L-(azetidine-d5)-2-carboxylic Acid
TRC-N524977-25MG 25 mg

N-Nitroso-L-(azetidine-d5)-2-carboxylic Acid

Sign In for Pricing
View Details
Human sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-EL-H6149-01 24 Tests

Human sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details
Human sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit
E-EL-H6149-02 48 Tests

Human sCD14 (Soluble Cluster of Differentiation 14) ELISA Kit

Sign In for Pricing
View Details