Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM10 Peptide - N-terminal region

PRDM10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PFM7

UniProt

Q9NQV6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_064613.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTPLGRLEAKEEEDEDEDEDTEEDEEEDGEDTDLDDWEPDPPRPFDPHDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC6 Antibody (Biotin)
KB-8205-01 50 μL

SIGLEC6 Antibody (Biotin)

Sign In for Pricing
View Details
SIGLEC6 Antibody (Biotin)
KB-8205-02 100 µL

SIGLEC6 Antibody (Biotin)

Sign In for Pricing
View Details
SIGLEC6 Antibody (Biotin)
KB-8205-03 1 mL

SIGLEC6 Antibody (Biotin)

Sign In for Pricing
View Details
Human KIAA1310 (KANSL3) activation kit by CRISPRa
GA110880 1 Kit

Human KIAA1310 (KANSL3) activation kit by CRISPRa

Sign In for Pricing
View Details
Human COQ5 activation kit by CRISPRa
GA113471 1 Kit

Human COQ5 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Sortilin/SORT1 protein (His tag)
PDMH100066-01 20 µg

Recombinant Human Sortilin/SORT1 protein (His tag)

Sign In for Pricing
View Details