Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAPT1 Peptide - C-terminal region

TAPT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMVFR

UniProt

Q6NXT6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_699196.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKDLLEIDRFTIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Unc13d Mouse Gene Knockout Kit (CRISPR)
KN518703 1 Kit

Unc13d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A10 Mouse Monoclonal Antibody [Clone ID: 4E7E10]
AM06161SU-N 100 µL

S100A10 Mouse Monoclonal Antibody [Clone ID: 4E7E10]

Sign In for Pricing
View Details
CD45RB (BRA-11G), 1mg/mL
BNUM0174-50 1x 50 µL

CD45RB (BRA-11G), 1mg/mL

Sign In for Pricing
View Details
Human SPATC1 activation kit by CRISPRa
GA117829 1 Kit

Human SPATC1 activation kit by CRISPRa

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody [Clone ID: OTI8A11]
CF805566 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI8A11]

Sign In for Pricing
View Details
2010003K11Rik Mouse Gene Knockout Kit (CRISPR)
KN500202 1 Kit

2010003K11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details