Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAPT1 Peptide - C-terminal region

TAPT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CMVFR

UniProt

Q6NXT6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_699196.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKDLLEIDRFTIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F4/80 Recombinant Chimeric Antibody Antibody
HA610357 100 µL

F4/80 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Pyridine-3-carboxaldehyde Thiosemicarbazone
TRC-P991348-250MG 250 mg

Pyridine-3-carboxaldehyde Thiosemicarbazone

Sign In for Pricing
View Details
SHOX2 (NM_006884) Human Recombinant Protein
TP760471 50 µg

SHOX2 (NM_006884) Human Recombinant Protein

Sign In for Pricing
View Details
CD79a (IGA/1688R), 0.2mg/mL
BNUB1688-500 1x 500 µL

CD79a (IGA/1688R), 0.2mg/mL

Sign In for Pricing
View Details
4-Chlorophenyl Benzoate
TRC-C375180-2.5G 2.5 g

4-Chlorophenyl Benzoate

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL
BNC400826-500 1x 500 µL

Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details