TMED10 Peptide - middle region
TMED10 Peptide - middle region
Product Specifications
Product Name Alternative
P23, TMP21, S31I125, Tmp-21-I, S31III125, P24 (DELTA)
UniProt
P49755
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_006818.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8424695-01 0.12 mL
Rabbit Anti Human SEPT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
Sign In for Pricing
View Details MBS8424695-02 5x 0.12 mL
Rabbit Anti Human SEPT1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
Sign In for Pricing
View Details 
K3533406 1.0 µg DNA
Dexi sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details