Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED10 Peptide - middle region

TMED10 Peptide - middle region

Product Specifications

Product Name Alternative

P23, TMP21, S31I125, Tmp-21-I, S31III125, P24 (DELTA)

UniProt

P49755

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006818.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Dysenteriae apaH Protein (aa 1-282)
VAng-Lsx06741-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae apaH Protein (aa 1-282)

Sign In for Pricing
View Details
MACF1 ORF Vector (Human) (pORF)
27882011 1.0 µg DNA

MACF1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal FMRFamide Antibody
NBP2-89002 50 µL

Rabbit Polyclonal FMRFamide Antibody

Sign In for Pricing
View Details
MMACHC Rabbit Polyclonal Antibody (Fluoro488)
orb3108008 100 µg

MMACHC Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
TIMP-4 Rabbit Polyclonal Antibody (BF647)
orb2558405 100 µL

TIMP-4 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
ANP32E Rabbit Polyclonal Antibody
E10G11893 100 µL

ANP32E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details