Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDG Peptide - middle region

TDG Peptide - middle region

Product Specifications

Product Name Alternative

HTDG

UniProt

Q13569

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003202.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPA Recombinant Rabbit monoclonal Antibody
HA722941 100 µL

ASPA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/3156R), CF568 conjugate, 0.1mg/mL
BNC683156-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/3156R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem9b Mouse Gene Knockout Kit (CRISPR)
KN517920 1 Kit

Tmem9b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol) Sodium Salt
TRC-P160980-25MG 25 mg

1-Palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol) Sodium Salt

Sign In for Pricing
View Details
Recombinant Human RAB11B Protein (His Tag)
PKSH030533 100 µg

Recombinant Human RAB11B Protein (His Tag)

Sign In for Pricing
View Details
CD300LD Antibody
KC-42902-01 50 μL

CD300LD Antibody

Sign In for Pricing
View Details