Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDG Peptide - middle region

TDG Peptide - middle region

Product Specifications

Product Name Alternative

HTDG

UniProt

Q13569

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003202.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heparanase 1 (HPSE) (NM_006665) Human Over-expression Lysate
LY401992 100 µg

Heparanase 1 (HPSE) (NM_006665) Human Over-expression Lysate

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF488A conjugate, 0.1mg/mL
BNC880853-100 1x 100 µL

P34 / cdk1 (POH-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LYSMD4 (N-term) Rabbit Polyclonal Antibody
AP52571PU-N 400 µL

LYSMD4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caspase-14 Antibody (Biotin)
KB-3707-01 50 μL

Caspase-14 Antibody (Biotin)

Sign In for Pricing
View Details
Caspase-14 Antibody (Biotin)
KB-3707-02 100 µL

Caspase-14 Antibody (Biotin)

Sign In for Pricing
View Details
Caspase-14 Antibody (Biotin)
KB-3707-03 1 mL

Caspase-14 Antibody (Biotin)

Sign In for Pricing
View Details