Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNRD1 Peptide - middle region

TXNRD1 Peptide - middle region

Product Specifications

Product Name Alternative

TR, TR1, TXNR, TRXR1, GRIM-12

UniProt

Q16881

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001087240.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calbindin 1 (CALB1) (CALB1/2364), Biotin conjugate, 0.1mg/mL
BNCB2364-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2364), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS633388 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), 0.2mg/mL
BNUB1775-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), 0.2mg/mL

Sign In for Pricing
View Details
Vat Violet 13 (Technical Grade)
TRC-V995043-100MG 100 mg

Vat Violet 13 (Technical Grade)

Sign In for Pricing
View Details
Spink8 Mouse Gene Knockout Kit (CRISPR)
KN516622 1 Kit

Spink8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SRMS Human Gene Knockout Kit (CRISPR)
KN221920BN 1 Kit

SRMS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details