Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNRD1 Peptide - middle region

TXNRD1 Peptide - middle region

Product Specifications

Product Name Alternative

TR, TR1, TXNR, TRXR1, GRIM-12

UniProt

Q16881

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001087240.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E-EL-H6005-01 24 Tests

Human MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E-EL-H6005-02 48 Tests

Human MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details
Human MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit
E-EL-H6005-03 96 Tests

Human MCP-1 (Monocyte Chemotactic Protein 1) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS803241 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
NRG2 Polyclonal Antibody
E-AB-19325-01 20 µL

NRG2 Polyclonal Antibody

Sign In for Pricing
View Details
NRG2 Polyclonal Antibody
E-AB-19325-02 60 µL

NRG2 Polyclonal Antibody

Sign In for Pricing
View Details