Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAMBI Peptide - middle region

BAMBI Peptide - middle region

Product Specifications

Product Name Alternative

NMA

UniProt

Q13145

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036474.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Argonaute 2 Monoclonal Antibody
E-AB-81531-01 50 µL

Recombinant Argonaute 2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Argonaute 2 Monoclonal Antibody
E-AB-81531-02 100 µL

Recombinant Argonaute 2 Monoclonal Antibody

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF568 conjugate, 0.1mg/mL
BNC681951-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Hydroxybut-2-ynoic Acid
TRC-H977653-50MG 50 mg

4-Hydroxybut-2-ynoic Acid

Sign In for Pricing
View Details
BAFF (TNFSF13B) (NM_006573) Human Over-expression Lysate
LC401966 20 µg

BAFF (TNFSF13B) (NM_006573) Human Over-expression Lysate

Sign In for Pricing
View Details
BOLA1 Polyclonal Antibody
E-AB-18542-01 20 µL

BOLA1 Polyclonal Antibody

Sign In for Pricing
View Details