Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAMBI Peptide - middle region

BAMBI Peptide - middle region

Product Specifications

Product Name Alternative

NMA

UniProt

Q13145

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036474.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bullet Ice Maker BIBU-102
BIBU-102 1 Unit

Bullet Ice Maker BIBU-102

Sign In for Pricing
View Details
ZFTA Human Gene Knockout Kit (CRISPR)
KN427247 1 Kit

ZFTA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3Alpha,4Beta-Dihydroxy-5Alpha-androstan-17-one
TRC-D488270-5MG 5 mg

3Alpha,4Beta-Dihydroxy-5Alpha-androstan-17-one

Sign In for Pricing
View Details
3-(3-Aminopropyl)benzoic Acid Hydrochloride
TRC-A628245-10MG 10 mg

3-(3-Aminopropyl)benzoic Acid Hydrochloride

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB24), 0.2mg/mL
BNUB0024-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS515298 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details