Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ9 Peptide - middle region

COQ9 Peptide - middle region

Product Specifications

Product Name Alternative

COQ10D5, C16orf49

UniProt

O75208

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_064708.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trametiglue
BA6498-5 5 mg

Trametiglue

Sign In for Pricing
View Details
Calcyphosin (CAPS) Antibody
abx346211-01 20 µg

Calcyphosin (CAPS) Antibody

Sign In for Pricing
View Details
Calcyphosin (CAPS) Antibody
abx346211-02 50 µg

Calcyphosin (CAPS) Antibody

Sign In for Pricing
View Details
Calcyphosin (CAPS) Antibody
abx346211-03 100 µg

Calcyphosin (CAPS) Antibody

Sign In for Pricing
View Details
Calcyphosin (CAPS) Antibody
abx346211-04 200 µg

Calcyphosin (CAPS) Antibody

Sign In for Pricing
View Details
Calcyphosin (CAPS) Antibody
abx346211-05 1 mg

Calcyphosin (CAPS) Antibody

Sign In for Pricing
View Details