COQ9 Peptide - middle region
COQ9 Peptide - middle region
Product Specifications
Product Name Alternative
COQ10D5, C16orf49
UniProt
O75208
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_064708.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PYIEHWPRALSILMLPHNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRR
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4687007 1.0 µg DNA
Psme3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 158288 10 mg
1- (4'-Methoxy[1,1'-biphenyl]-2-yl) -piperazine Hydrochloride
Sign In for Pricing
View Details 
LV671153 1.0 µg DNA
MPST Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details O6160-05A-APC 200 µL
OR2H2, CT (Olfactory Receptor 2H3, Hs6M1-12, Olfactory Receptor-like Protein FAT11, Olfactory Receptor 2H2, OR2H3, OLFR2, FAT11) (APC) discontinued
Sign In for Pricing
View Details VAng-Wyb6621-1mgEcoli 1 mg (E. coli)
Recombinant Plasmodium Falciparum PCNA Protein (aa 1-274) (isolate 3D7)
Sign In for Pricing
View Details