Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL1 Peptide - middle region

NEIL1 Peptide - middle region

Product Specifications

Product Name Alternative

FPG1, NEI1, hFPG1

UniProt

Q96FI4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243481.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLC4K Conjugated Antibody
C35798 100 µL

CLC4K Conjugated Antibody

Sign In for Pricing
View Details
pOTB7-MRPS6 Plasmid
PVT25584 2 µg

pOTB7-MRPS6 Plasmid

Sign In for Pricing
View Details
DCAF6 Polyclonal Antibody
E-AB-13470-01 20 µL

DCAF6 Polyclonal Antibody

Sign In for Pricing
View Details
DCAF6 Polyclonal Antibody
E-AB-13470-02 60 µL

DCAF6 Polyclonal Antibody

Sign In for Pricing
View Details
DCAF6 Polyclonal Antibody
E-AB-13470-03 120 µL

DCAF6 Polyclonal Antibody

Sign In for Pricing
View Details
DCAF6 Polyclonal Antibody
E-AB-13470-04 200 µL

DCAF6 Polyclonal Antibody

Sign In for Pricing
View Details