Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEIL1 Peptide - middle region

NEIL1 Peptide - middle region

Product Specifications

Product Name Alternative

FPG1, NEI1, hFPG1

UniProt

Q96FI4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243481.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BCMA/Tnfrsf17 Antibody Picoband®, iFluor647 Conjugate
A01014-4-iFluor647 100 µg

Anti-BCMA/Tnfrsf17 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
ATP1A4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12675124 3x 1.0µg DNA

ATP1A4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
INO80E Rabbit Polyclonal Antibody (HRP)
orb472273 100 µL

INO80E Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GSTM5 Protein Vector (Mouse) (pPB-C-His)
PV187026 500 ng

GSTM5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
BDH1 Rabbit Polyclonal Antibody
AP21323PU-N 1 mg

BDH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal UBE2G2 Antibody (OTI1B10) [DyLight 350]
NBP2-74746UV 0.1 mL

Mouse Monoclonal UBE2G2 Antibody (OTI1B10) [DyLight 350]

Sign In for Pricing
View Details