Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I2 Peptide - middle region

DYNC1I2 Peptide - middle region

Product Specifications

Product Name Alternative

IC2, DNCI2

UniProt

Q13409

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258714.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ubiquitin Antibody
R-182-250 250 µg

Anti-Ubiquitin Antibody

Sign In for Pricing
View Details
TdcB Antibody
orb833730 2 mg

TdcB Antibody

Sign In for Pricing
View Details
Nkx2.6 Rabbit Polyclonal Antibody (BF555)
orb2441989 100 µL

Nkx2.6 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
ACE2 Antibody (Biotin)
orb1240301-01 0.02 mg

ACE2 Antibody (Biotin)

Sign In for Pricing
View Details
ACE2 Antibody (Biotin)
orb1240301-02 0.1 mg

ACE2 Antibody (Biotin)

Sign In for Pricing
View Details
Mussaendoside S
QGA19841-01 1 mg

Mussaendoside S

Sign In for Pricing
View Details