Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1I2 Peptide - middle region

DYNC1I2 Peptide - middle region

Product Specifications

Product Name Alternative

IC2, DNCI2

UniProt

Q13409

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258714.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCK (Deoxycytidine Kinase, MGC117410, MGC138632) (HRP)
MBS6182335-01 0.1 mL

DCK (Deoxycytidine Kinase, MGC117410, MGC138632) (HRP)

Sign In for Pricing
View Details
DCK (Deoxycytidine Kinase, MGC117410, MGC138632) (HRP)
MBS6182335-02 5x 0.1 mL

DCK (Deoxycytidine Kinase, MGC117410, MGC138632) (HRP)

Sign In for Pricing
View Details
Anti-GRHL2 Antibody Picoband® Fluoro647 Conjugated
A04120-2-Fluoro647 100 µg/Vial

Anti-GRHL2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
FABP5 (Fatty Acid Binding Protein 5, E-FABP, EFABP, PA-FABP, PAFABP) (Biotin)
MBS6416719-01 0.1 mL

FABP5 (Fatty Acid Binding Protein 5, E-FABP, EFABP, PA-FABP, PAFABP) (Biotin)

Sign In for Pricing
View Details
FABP5 (Fatty Acid Binding Protein 5, E-FABP, EFABP, PA-FABP, PAFABP) (Biotin)
MBS6416719-02 5x 0.1 mL

FABP5 (Fatty Acid Binding Protein 5, E-FABP, EFABP, PA-FABP, PAFABP) (Biotin)

Sign In for Pricing
View Details
BAT3 Rabbit Monoclonal Antibody
AMRe84620-01 1 Each

BAT3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details