Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAXBP1 Peptide - middle region

PAXBP1 Peptide - middle region

Product Specifications

Product Name Alternative

GCFC, BM020, GCFC1, FSAP105, C21orf66

UniProt

Q9Y5B6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_037461.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MID1IP1 Goat Polyclonal Antibody
AP22415PU-N 100 µg

MID1IP1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Polypyrrole (undoped, extent of labeling: ~20 wt. % loading, composite with carbon black)
TRC-P698945-500MG 500 mg

Polypyrrole (undoped, extent of labeling: ~20 wt. % loading, composite with carbon black)

Sign In for Pricing
View Details
SAE1 (NM_001145713) Human Recombinant Protein
TP326908 20 µg

SAE1 (NM_001145713) Human Recombinant Protein

Sign In for Pricing
View Details
SLC25A39 (NM_001143780) Human Over-expression Lysate
LY428341 100 µg

SLC25A39 (NM_001143780) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-Ru(OAc)2(BINAP)
TRC-O148455-500MG 500 mg

(S)-Ru(OAc)2(BINAP)

Sign In for Pricing
View Details
Ube2u Mouse Gene Knockout Kit (CRISPR)
KN518592 1 Kit

Ube2u Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details