Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAXBP1 Peptide - middle region

PAXBP1 Peptide - middle region

Product Specifications

Product Name Alternative

GCFC, BM020, GCFC1, FSAP105, C21orf66

UniProt

Q9Y5B6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_037461.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66, pan (CEA) (Cocktail), CF647 conjugate, 0.1mg/mL
BNC471139-500 1x 500 µL

CD66, pan (CEA) (Cocktail), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSK 525762A
TRC-G797505-25MG 25 mg

GSK 525762A

Sign In for Pricing
View Details
Ccdc43 Mouse Gene Knockout Kit (CRISPR)
KN502717 1 Kit

Ccdc43 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802048 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific,  40nm
GAF-441-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse IgG, Fc Specific, 40nm

Sign In for Pricing
View Details
Cmc2 (NM_026844) Mouse Tagged ORF Clone
MG200130 10 µg

Cmc2 (NM_026844) Mouse Tagged ORF Clone

Sign In for Pricing
View Details