Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPPA Peptide - middle region

GMPPA Peptide - middle region

Product Specifications

Product Name Alternative

AAMR

UniProt

Q96IJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_037467.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-PAIP2 (human) -Neo
BZ60393 1 Vial

PCMV-EGFP-PAIP2 (human) -Neo

Sign In for Pricing
View Details
FUCA1P siRNA Oligos set (Human)
57725171 3x 5 nmol

FUCA1P siRNA Oligos set (Human)

Sign In for Pricing
View Details
TRPC3 (NT) (Transient Receptor Potential Cation Channel, Subfamily C, Member 3, HTRP-3, HTRP3, TRP3) (MaxLight 405) discontinued
T8666-14C-ML405 100 µL

TRPC3 (NT) (Transient Receptor Potential Cation Channel, Subfamily C, Member 3, HTRP-3, HTRP3, TRP3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SYNPR Mouse Monoclonal Antibody
AMM83606-01 1 Each

SYNPR Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SYNPR Mouse Monoclonal Antibody
AMM83606-02 50 µL

SYNPR Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SYNPR Mouse Monoclonal Antibody
AMM83606-03 100 µL

SYNPR Mouse Monoclonal Antibody

Sign In for Pricing
View Details