Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMPPA Peptide - middle region

GMPPA Peptide - middle region

Product Specifications

Product Name Alternative

AAMR

UniProt

Q96IJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_037467.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-ECFP-Stim1-Neo Plasmid
PVT64348 2 µg

PCMV-ECFP-Stim1-Neo Plasmid

Sign In for Pricing
View Details
HP-1Gamma mouse Monoclonal Antibody(2F5)
JOT-MCA0051-01 20 µL

HP-1Gamma mouse Monoclonal Antibody(2F5)

Sign In for Pricing
View Details
HP-1Gamma mouse Monoclonal Antibody(2F5)
JOT-MCA0051-02 50 μL

HP-1Gamma mouse Monoclonal Antibody(2F5)

Sign In for Pricing
View Details
HP-1Gamma mouse Monoclonal Antibody(2F5)
JOT-MCA0051-03 100 µL

HP-1Gamma mouse Monoclonal Antibody(2F5)

Sign In for Pricing
View Details
Hybex™ Media storage bottle, 500ml with standard (GL45) blue cap, 10/pk.
B3000-500-B* 1 Each

Hybex™ Media storage bottle, 500ml with standard (GL45) blue cap, 10/pk.

Sign In for Pricing
View Details
Kylt® ASF/CSF Triplex
31825 25 Reactions

Kylt® ASF/CSF Triplex

Sign In for Pricing
View Details