What is the catalog number for IPO4 Peptide - middle region?

The catalog number for IPO4 Peptide - middle region is orb1999515.

What sizes are available for IPO4 Peptide - middle region?

IPO4 Peptide - middle region is available in the following size(s): 100 µg.

Is IPO4 Peptide - middle region in stock?

IPO4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

Imp4

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078934.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSKALLKNRLLPPLLHTLFPIVAAEPPPGQLDPEDQDSEEEELEIELMGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY-RS09881 1 Set

OVCA2 Human Pre-designed siRNA Set A

Sign In for Pricing

View Details

EKU12113 96 Tests

Rat Interleukin 1 Receptor Type I (IL1R1) ELISA Kit

Sign In for Pricing

View Details

40712011 1.0 µg DNA

RPA4 ORF Vector (Human) (pORF)

Sign In for Pricing

View Details

TRV-0022055-01 200 µL

Biotin-Linked Polyclonal Antibody to Urotensin 2 (UST2)

Sign In for Pricing

View Details

TRV-0022055-02 1 mL

Biotin-Linked Polyclonal Antibody to Urotensin 2 (UST2)

Sign In for Pricing

View Details

MG221662 10 µg

Kcnj2 (NM_008425) Mouse Tagged ORF Clone

Sign In for Pricing

View Details