Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO4 Peptide - middle region

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

Imp4

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078934.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSKALLKNRLLPPLLHTLFPIVAAEPPPGQLDPEDQDSEEEELEIELMGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC111 (h) : 293T Lysate
sc-116974 100 µg - 200 µL

CCDC111 (h) : 293T Lysate

Sign In for Pricing
View Details
Outer capsid glycoprotein VP7 Antibody
abx319780-01 20 µg

Outer capsid glycoprotein VP7 Antibody

Sign In for Pricing
View Details
Outer capsid glycoprotein VP7 Antibody
abx319780-02 50 µg

Outer capsid glycoprotein VP7 Antibody

Sign In for Pricing
View Details
Outer capsid glycoprotein VP7 Antibody
abx319780-03 100 µg

Outer capsid glycoprotein VP7 Antibody

Sign In for Pricing
View Details
Outer capsid glycoprotein VP7 Antibody
abx319780-04 200 µg

Outer capsid glycoprotein VP7 Antibody

Sign In for Pricing
View Details
Outer capsid glycoprotein VP7 Antibody
abx319780-05 1 mg

Outer capsid glycoprotein VP7 Antibody

Sign In for Pricing
View Details