Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC1 Peptide - middle region

KDELC1 Peptide - middle region

Product Specifications

Product Name Alternative

EP58, ERp58, KDEL1

UniProt

Q6UW63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076994.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFRIFMDAILLSLTRKVKMPDVELFVNLGDWPLEKKKSNSNIHPIFSWCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap10 Mouse Gene Knockout Kit (CRISPR)
KN501062 1 Kit

Akap10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF405S conjugate, 0.1mg/mL
BNC042240-500 1x 500 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fadrozole Hydrochloride
TRC-F101048-25MG 25 mg

Fadrozole Hydrochloride

Sign In for Pricing
View Details
Bi(alanine 2-Ethylbutyl Ester)Phenyl Phosphenite
TRC-B080510-1G 1 g

Bi(alanine 2-Ethylbutyl Ester)Phenyl Phosphenite

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
TA504762BM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
2,3-Dihydro-5-benzofuranacetic Acid-d2
TRC-D448487-5MG 5 mg

2,3-Dihydro-5-benzofuranacetic Acid-d2

Sign In for Pricing
View Details