Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC1 Peptide - middle region

KDELC1 Peptide - middle region

Product Specifications

Product Name Alternative

EP58, ERp58, KDEL1

UniProt

Q6UW63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_076994.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFRIFMDAILLSLTRKVKMPDVELFVNLGDWPLEKKKSNSNIHPIFSWCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCK1 Rabbit Monoclonal Antibody
TA423918 100 µL

PCK1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CNN2 Antibody
8C14881-AAT 50 µg

CNN2 Antibody

Sign In for Pricing
View Details
Human C3IP1 (KLHL12) activation kit by CRISPRa
GA111833 1 Kit

Human C3IP1 (KLHL12) activation kit by CRISPRa

Sign In for Pricing
View Details
(5alpha,17alpha)-17-Hydroxypregn-20-yn-3-one
TRC-H345890-50MG 50 mg

(5alpha,17alpha)-17-Hydroxypregn-20-yn-3-one

Sign In for Pricing
View Details
TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate
LC433001 20 µg

TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate

Sign In for Pricing
View Details
Benchtop High Speed Centrifuge BCBH-305
BCBH-305 1 Unit

Benchtop High Speed Centrifuge BCBH-305

Sign In for Pricing
View Details