Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL13 Peptide - middle region

MRPL13 Peptide - middle region

Product Specifications

Product Name Alternative

L13, L13A, L13mt, RPL13, RPML13

UniProt

Q9BYD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_054797.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LECT2 3'UTR Luciferase Stable Cell Line
TU012372 1.0 mL

LECT2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-DLG4/PSD95 (K28/43) (Mouse, Monoclonal, IgG2a, kappa)
A130288 100 µL

Anti-DLG4/PSD95 (K28/43) (Mouse, Monoclonal, IgG2a, kappa)

Sign In for Pricing
View Details
Anti-Human CD335/NCR1/NKp46 Monoclonal Antibody (8E5#)
PTX21565 100 µg

Anti-Human CD335/NCR1/NKp46 Monoclonal Antibody (8E5#)

Sign In for Pricing
View Details
Recombinant Anti-GATA6 Rabbit mAb
CMA5774-01 30 µL

Recombinant Anti-GATA6 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-GATA6 Rabbit mAb
CMA5774-02 50 μL

Recombinant Anti-GATA6 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-GATA6 Rabbit mAb
CMA5774-03 100 µL

Recombinant Anti-GATA6 Rabbit mAb

Sign In for Pricing
View Details