Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN2 Peptide - N-terminal region

PFDN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PFD2

UniProt

Q9UHV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036526.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-8/CXCL8 MAb (Clone 1028311)
MAB2082-100 100 µg

Human IL-8/CXCL8 MAb (Clone 1028311)

Sign In for Pricing
View Details
Nandrolone (1.0 mg/mL in Acetonitrile)
TRC-KIT0190-10X1ML 10x 1 mL

Nandrolone (1.0 mg/mL in Acetonitrile)

Sign In for Pricing
View Details
PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody [Clone ID: OTI3F8]
TA801641 100 µL

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

Sign In for Pricing
View Details
Gastrotropin (FABP6) Human ELISA Kit
D6387 96 Tests

Gastrotropin (FABP6) Human ELISA Kit

Sign In for Pricing
View Details
PMCH Rabbit Polyclonal Antibody (BF488)
orb2477067 100 µL

PMCH Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
ZNF22 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-12803R-PerCP-Cy5.5 100 µL

ZNF22 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details