What is the catalog number for RBM34 Peptide - C-terminal region?

The catalog number for RBM34 Peptide - C-terminal region is orb1999505.

What sizes are available for RBM34 Peptide - C-terminal region?

RBM34 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is RBM34 Peptide - C-terminal region in stock?

RBM34 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

RBM34 Peptide - C-terminal region

Product Specifications

UniProt

P42696

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001155005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-347255 1 g

[ (3-phenylpropyl) thio]acetic acid

Sign In for Pricing

View Details

MBS9364875-01 48 Well

Porcine RNA-binding Protein Musashi Homolog 2 (MSI2) ELISA Kit

Sign In for Pricing

View Details

MBS9364875-02 96 Well

Porcine RNA-binding Protein Musashi Homolog 2 (MSI2) ELISA Kit

Sign In for Pricing

View Details

MBS9364875-03 5x 96 Well

Porcine RNA-binding Protein Musashi Homolog 2 (MSI2) ELISA Kit

Sign In for Pricing

View Details

MBS9364875-04 10x 96 Well

Porcine RNA-binding Protein Musashi Homolog 2 (MSI2) ELISA Kit

Sign In for Pricing

View Details

S6787-5mg 5 mg

KN-93

Sign In for Pricing

View Details