What is the catalog number for RBM34 Peptide - C-terminal region?

The catalog number for RBM34 Peptide - C-terminal region is orb1999505.

What sizes are available for RBM34 Peptide - C-terminal region?

RBM34 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is RBM34 Peptide - C-terminal region in stock?

RBM34 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

RBM34 Peptide - C-terminal region

Product Specifications

UniProt

P42696

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001155005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

79-853 0.1 mg

MER/SKY (phospho Tyr749/681) Antibody

Sign In for Pricing

View Details

PR27269-01 2 µg

C1D

Sign In for Pricing

View Details

PR27269-02 10 µg

C1D

Sign In for Pricing

View Details

MBS050085 Inquire

Donkey Complement Component 1, Q Subcomponent A ELISA Kit

Sign In for Pricing

View Details

EK11F551-01 48 Test

Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit-Sandwich

Sign In for Pricing

View Details

EK11F551-02 96 Tests

Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit-Sandwich

Sign In for Pricing

View Details