Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULBP2 Peptide - middle region

ULBP2 Peptide - middle region

Product Specifications

Product Name Alternative

N2DL2, RAET1H, NKG2DL2, ALCAN-alpha

UniProt

Q9BZM5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079493.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSCR9 Human qPCR Primer Pair (NM_148675)
HP217542 200 Reactions

DSCR9 Human qPCR Primer Pair (NM_148675)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serum Amyloid A (SAA)
TRV-0022897-01 200 µL

Biotin-Linked Polyclonal Antibody to Serum Amyloid A (SAA)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Serum Amyloid A (SAA)
TRV-0022897-02 1 mL

Biotin-Linked Polyclonal Antibody to Serum Amyloid A (SAA)

Sign In for Pricing
View Details
UGT1A7 Rabbit Polyclonal Antibody
orb313418-01 50 μL

UGT1A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A7 Rabbit Polyclonal Antibody
orb313418-02 100 µL

UGT1A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A7 Rabbit Polyclonal Antibody
orb313418-03 200 µL

UGT1A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details