Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD4 Peptide - middle region

MBD4 Peptide - middle region

Product Specifications

Product Name Alternative

MED1

UniProt

O95243

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001263199.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKYNKEALSPPRRK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal anti-mouse CCL-3
mAP-0180 50 µg

Rat Monoclonal anti-mouse CCL-3

Sign In for Pricing
View Details
2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone
266224-01 500 mg

2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone

Sign In for Pricing
View Details
2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone
266224-02 1 g

2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone

Sign In for Pricing
View Details
2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone
266224-03 2 g

2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone

Sign In for Pricing
View Details
2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone
266224-04 5 g

2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone

Sign In for Pricing
View Details
2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone
266224-05 10 g

2-Bromo-1- (5-fluoro-2-methoxy-3-nitrophenyl) ethanone

Sign In for Pricing
View Details