APOM Peptide - middle region
APOM Peptide - middle region
Product Specifications
Product Name Alternative
G3a, NG20, apo-M, HSPC336
UniProt
O95445
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001243098.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CK-bio-17564-01 48 Tests
Porcine brain natriuretic peptide, BNP ELISA Kit
Sign In for Pricing
View Details CK-bio-17564-02 96 Tests
Porcine brain natriuretic peptide, BNP ELISA Kit
Sign In for Pricing
View Details CK-bio-17564-03 5x 96 Tests
Porcine brain natriuretic peptide, BNP ELISA Kit
Sign In for Pricing
View Details CK-bio-17564-04 10x 96 Tests
Porcine brain natriuretic peptide, BNP ELISA Kit
Sign In for Pricing
View Details