Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSG Peptide - N-terminal region

CTSG Peptide - N-terminal region

Product Specifications

Product Name Alternative

CG, CATG

UniProt

P08311

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001902.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-500 1x 500 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details