Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAB1 Peptide - N-terminal region

TAB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3&apos, -Tab1, MAP3K7IP1

UniProt

Q15750

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006107.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPMS2 Human Gene Knockout Kit (CRISPR)
KN419559 1 Kit

RBPMS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF568 conjugate, 0.1mg/mL
BNC682748-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Peroxiredoxin 1 (PRDX1) Human Knockdown Lysate
LY300276 100 µg

Peroxiredoxin 1 (PRDX1) Human Knockdown Lysate

Sign In for Pricing
View Details
MEK4 (MAP2K4) (NM_003010) Human Over-expression Lysate
LC401058 20 µg

MEK4 (MAP2K4) (NM_003010) Human Over-expression Lysate

Sign In for Pricing
View Details
Aurora B (AURKB) Mouse Monoclonal Antibody [Clone ID: AT2B1]
AM09372PU-N 100 µL

Aurora B (AURKB) Mouse Monoclonal Antibody [Clone ID: AT2B1]

Sign In for Pricing
View Details
ACAA2 (NM_006111) Human Over-expression Lysate
LC401843 20 µg

ACAA2 (NM_006111) Human Over-expression Lysate

Sign In for Pricing
View Details