Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAB1 Peptide - N-terminal region

TAB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

3&apos, -Tab1, MAP3K7IP1

UniProt

Q15750

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006107.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-(6,8-Dibromo-3(4H)-quinazolinyl)-cyclohexanol
TRC-D425970-100MG 100 mg

4-(6,8-Dibromo-3(4H)-quinazolinyl)-cyclohexanol

Sign In for Pricing
View Details
Recombinant SNIP1 Antibody
RN-14942-01 50 μL

Recombinant SNIP1 Antibody

Sign In for Pricing
View Details
Recombinant SNIP1 Antibody
RN-14942-02 100 µL

Recombinant SNIP1 Antibody

Sign In for Pricing
View Details
Recombinant SNIP1 Antibody
RN-14942-03 1 mL

Recombinant SNIP1 Antibody

Sign In for Pricing
View Details
p-Chloroaniline Hydrochloride
TRC-C364450-10G 10 g

p-Chloroaniline Hydrochloride

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3194), CF488A conjugate, 0.1mg/mL
BNC883194-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3194), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details