Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3A1 Peptide - C-terminal region

ALDH3A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH3, ALDHIII

UniProt

P30838

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000682.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human FCRL2 pAb
PA4925-01 50 μL

Rabbit Anti-Human FCRL2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human FCRL2 pAb
PA4925-02 100 μL

Rabbit Anti-Human FCRL2 pAb

Sign In for Pricing
View Details
CG-806 50mg
A19814-50 50 mg

CG-806 50mg

Sign In for Pricing
View Details
C1orf38 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14202111 3x 1.0 µg

C1orf38 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mir29b-1 Mouse qPCR Template Standard (MI0000143)
MK300236 200 Reactions

Mir29b-1 Mouse qPCR Template Standard (MI0000143)

Sign In for Pricing
View Details
Rat Big ET ELISA Kit
ELA-E0483r 96 Tests

Rat Big ET ELISA Kit

Sign In for Pricing
View Details