Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH3A1 Peptide - C-terminal region

ALDH3A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALDH3, ALDHIII

UniProt

P30838

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000682.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPS1 Adenovirus (Mouse)
48528054 1.0 mL

TRPS1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Dpysl5 (NM_023023) Rat Tagged Lenti ORF Clone
RR207323L3 10 µg

Dpysl5 (NM_023023) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chicken Glutathione S-transferases (GSTs) ELISA Kit
AE64612CH-01 48 Tests

Chicken Glutathione S-transferases (GSTs) ELISA Kit

Sign In for Pricing
View Details
Chicken Glutathione S-transferases (GSTs) ELISA Kit
AE64612CH-02 96 Tests

Chicken Glutathione S-transferases (GSTs) ELISA Kit

Sign In for Pricing
View Details
Beclin-1 (Beclin 1 (Coiled-coil Moesin-like BCL2-interacting Protein), Beclin1, BECN1, APG6, ATG6, ATG6 Autophagy-related 6 Homolog, Coiled-coil Myosin-like Bcl-2-Interacting Protein, GT197, Protein GT197, VPS30) (Biotin)
B0981-23R 100 µL

Beclin-1 (Beclin 1 (Coiled-coil Moesin-like BCL2-interacting Protein), Beclin1, BECN1, APG6, ATG6, ATG6 Autophagy-related 6 Homolog, Coiled-coil Myosin-like Bcl-2-Interacting Protein, GT197, Protein GT197, VPS30) (Biotin)

Sign In for Pricing
View Details
MIF098
BA6078-25 25 mg

MIF098

Sign In for Pricing
View Details