Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT2 Peptide - middle region

GIT2 Peptide - middle region

Product Specifications

Product Name Alternative

CAT2, CAT-2

UniProt

Q14161

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128685.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDS

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUSD5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2316907 1.0 µg DNA

SUSD5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
POEM shRNA (m) Lentiviral Particles
sc-152365-V 200 µL

POEM shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mrgpre 3'UTR Luciferase Stable Cell Line
TU113404 1.0 mL

Mrgpre 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CRNKL1 3'UTR GFP Stable Cell Line
TU055034 1.0 mL

CRNKL1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Toll-Like Receptor 4 (TLR4) Bovine ELISA Kit
H6690 96 Tests

Toll-Like Receptor 4 (TLR4) Bovine ELISA Kit

Sign In for Pricing
View Details
Monoclonal Tlr2 Antibody, Clone: 8F11G10
APG02994G 0.1ml

Monoclonal Tlr2 Antibody, Clone: 8F11G10

Sign In for Pricing
View Details