Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT2 Peptide - middle region

GIT2 Peptide - middle region

Product Specifications

Product Name Alternative

CAT2, CAT-2

UniProt

Q14161

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128685.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr518 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7258903 1.0 µg DNA

Olr518 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Glypican 3 Polyclonal Antibody
MBS8578965-01 0.1 mL

Glypican 3 Polyclonal Antibody

Sign In for Pricing
View Details
Glypican 3 Polyclonal Antibody
MBS8578965-02 0.1 mL (AF405L)

Glypican 3 Polyclonal Antibody

Sign In for Pricing
View Details
Glypican 3 Polyclonal Antibody
MBS8578965-03 0.1 mL (AF405S)

Glypican 3 Polyclonal Antibody

Sign In for Pricing
View Details
Glypican 3 Polyclonal Antibody
MBS8578965-04 0.1 mL (AF610)

Glypican 3 Polyclonal Antibody

Sign In for Pricing
View Details
Glypican 3 Polyclonal Antibody
MBS8578965-05 0.1 mL (AF635)

Glypican 3 Polyclonal Antibody

Sign In for Pricing
View Details