Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM2 Peptide - middle region

ADAM2 Peptide - middle region

Product Specifications

Product Name Alternative

CT15, FTNB, PH30, CRYN1, CRYN2, PH-30b, PH30-beta

UniProt

Q99965

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265042.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK1 Antibody HRP Conjugated
MBS9460979-01 0.1 mL

PAK1 Antibody HRP Conjugated

Sign In for Pricing
View Details
PAK1 Antibody HRP Conjugated
MBS9460979-02 5x 0.1 mL

PAK1 Antibody HRP Conjugated

Sign In for Pricing
View Details
Mouse PIDD siRNA
abx928547-01 15 nmol

Mouse PIDD siRNA

Sign In for Pricing
View Details
Mouse PIDD siRNA
abx928547-02 30 nmol

Mouse PIDD siRNA

Sign In for Pricing
View Details
Collagen 3 alpha 1 Antibody
E51A10021 100 µL

Collagen 3 alpha 1 Antibody

Sign In for Pricing
View Details
HIST1H2BK Antibody; HRP conjugated
MBS7005348-01 0.05 mg

HIST1H2BK Antibody; HRP conjugated

Sign In for Pricing
View Details