What is the catalog number for ADAM2 Peptide - middle region?

The catalog number for ADAM2 Peptide - middle region is orb1999479.

What sizes are available for ADAM2 Peptide - middle region?

ADAM2 Peptide - middle region is available in the following size(s): 100 µg.

Is ADAM2 Peptide - middle region in stock?

ADAM2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ADAM2 Peptide - middle region

Product Specifications

Product Name Alternative

CT15, FTNB, PH30, CRYN1, CRYN2, PH-30b, PH30-beta

UniProt

Q99965

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265042.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS9333499 Inquire

Rabbit Sterol 26-hydroxylase, mitochondrial, CYP27A1 ELISA Kit

Sign In for Pricing

View Details

K0886808 1.0 µg DNA

GPC5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing

View Details

E28PN5616 100 µL

EAAT2 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

NBP2-50251UV 0.1 mL

Mouse Monoclonal Plasma Cell Antibody (LIV3G11) [DyLight 350]

Sign In for Pricing

View Details

EKU11560 96 Tests

Folic Acid (FA) CLIA Kit

Sign In for Pricing

View Details

A0127 100 µL

SIRT1 Mouse mAb

Sign In for Pricing

View Details