Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC6 Peptide - N-terminal region

TMC6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EV1, EVER1, EVIN1, LAK-4P

UniProt

Q7Z403

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001120670.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLWRPEGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF405S conjugate, 0.1mg/mL
BNC041707-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]
TA803288AM 100 µL

CD68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details
Tas1r1 Mouse Gene Knockout Kit (CRISPR)
KN517186 1 Kit

Tas1r1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethylene Glycol Monooctanoate
TRC-E917545-250MG 250 mg

Ethylene Glycol Monooctanoate

Sign In for Pricing
View Details
Mini Centrifuge BCMI-403
BCMI-403 1 Unit

Mini Centrifuge BCMI-403

Sign In for Pricing
View Details
Recombinant ABCE1 Monoclonal Antibody
AN301424L-01 50 µL

Recombinant ABCE1 Monoclonal Antibody

Sign In for Pricing
View Details