Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF12 Peptide - C-terminal region

FGF12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FHF1, FGF12B

UniProt

P61328

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004104.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SAP30BP activation kit by CRISPRa
GA109246 1 Kit

Human SAP30BP activation kit by CRISPRa

Sign In for Pricing
View Details
Horse IgG F(c) Antibody Peroxidase Conjugated
TA397700 2 mg

Horse IgG F(c) Antibody Peroxidase Conjugated

Sign In for Pricing
View Details
MCM2 Recombinant Rabbit Monoclonal Antibody [JE42-39]
HA721553 100 µL

MCM2 Recombinant Rabbit Monoclonal Antibody [JE42-39]

Sign In for Pricing
View Details
AMACR Recombinant Rabbit monoclonal Antibody
HA751474 100 µL

AMACR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PD-L1 Antibody
OC-283-01 50 μL

PD-L1 Antibody

Sign In for Pricing
View Details
PD-L1 Antibody
OC-283-02 100 µL

PD-L1 Antibody

Sign In for Pricing
View Details