Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF12 Peptide - C-terminal region

FGF12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FHF1, FGF12B

UniProt

P61328

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004104.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F3]
TA501098BM 100 µL

NIT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F3]

Sign In for Pricing
View Details
CYLN2 (CLIP2) Human Gene Knockout Kit (CRISPR)
KN414875 1 Kit

CYLN2 (CLIP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NASP Rabbit Polyclonal Antibody
TA378932 100 µL

NASP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD38 Polyclonal Antibody
D-AB-10189L-01 25 µL

CD38 Polyclonal Antibody

Sign In for Pricing
View Details
CD38 Polyclonal Antibody
D-AB-10189L-02 100 µL

CD38 Polyclonal Antibody

Sign In for Pricing
View Details
MAPT / TAU pThr181 Rabbit Polyclonal Antibody
AP02399PU-N 100 µL

MAPT / TAU pThr181 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details