Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM3 Peptide - middle region

CEACAM3 Peptide - middle region

Product Specifications

Product Name Alternative

CEA, CGM1, W264, W282, CD66D

UniProt

P40198

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001264092.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eipr1 Mouse Gene Knockout Kit (CRISPR)
KN518376 1 Kit

Eipr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LB (Miller)
0114 500 mL

LB (Miller)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]
E-AB-F1328M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]
E-AB-F1328M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]
E-AB-F1328M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD43 Antibody[HI161]

Sign In for Pricing
View Details
TentaGel® RAP - TentaGel® Resin for the Synthesis of Resin Attached Peptides
J3002.25G 25 g

TentaGel® RAP - TentaGel® Resin for the Synthesis of Resin Attached Peptides

Sign In for Pricing
View Details